Tissue repair
LL-37 Pen
10mg · pre-filled pen
Cathelicidin antimicrobial peptide for research
£100Sold out
1
LL-37 is a 37-amino-acid antimicrobial peptide, the only known human cathelicidin-derived peptide. It is studied in laboratory research on innate immunity, antimicrobial activity and immunomodulatory signalling. Supplied as a pre-filled research pen.
- Independently tested · request the CoA
- Hologram label with a unique code. Check it’s genuine
- Free next-day UK delivery over £110
- Discreet, unbranded packaging
- Items reserved as soon as you order
Sold for laboratory research use only. Not for human or animal consumption.
Research applications
- Investigated for antimicrobial activity against microbial models
- Studied for immunomodulatory and host-defence signalling
- Examined for effects on cell migration and wound-repair models
- Used as a reference cathelicidin peptide in innate-immunity assays
Specifications
| Research area | Tissue repair |
|---|---|
| Form | Pre-filled pen |
| Quantity | 10mg per pen |
| Purity | >98% |
| Sequence | [LL-37, 37 aa] |
| Molecular weight | ~4493.3 g/mol |
| CAS | 154947-66-7 |
| Storage | Store lyophilised cool & dark (-20C); refrigerate at 2-8C after reconstitution |

